Home / Products / proteins / Meteorin, 22-291aa, Mouse, His tag, Insect cell (Bioactivity Validated)

Meteorin, 22-291aa, Mouse, His tag, Insect cell (Bioactivity Validated)

Categories: [Proteins / Peptides]
METRN, also known as meteorin, involved in both glial cell differentiation and axonal network formation during neurogenesis. It promotes astrocyte differentiation and transforms cerebellar astrocytes into radial glia. Also, this protein induces axonal extension in small and intermediate neurons of sensory ganglia by activating nearby satellite glia. Recombinant mouse METRN, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02955
Size 20 µg
Host Insect cell
Accession
Molecular Weight 30.2kDa (276aa) confirmed by MALDI-TOF 28-40KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences GYSEDRCSWRGSGLTQEPGSVGQLTLDCTEGAIEWLYPAGALRLTLGGPDPGTRPSIVCLRPERPFAGAQVFAERMTGNLELLLAEGPDLAGGRCMRWGPRERRALFLQATPHRDISRRVAAFRFELHEDQRAEMSPQAQGLGVDGACRPCSDAELLLAACTSDFVIHGTIHGVAHDTELQESVITVVVARVIRQTLPLFKEGSSEGQGRASIRTLLRCGVRPGPGSFLFMGWSRFGEAWLGCAPRFQEFSRVYSAALTTHLNPCEMALDHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Metrn, 1810034B16Rik, Hyrac
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap