Home / Products / proteins / MEMO1, 1-297aa, Human, His tag, E.coli

MEMO1, 1-297aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MEMO1 (Mediator of ErbB2-driven cell motility 1), also known as C2orf4 or NS5ATP7, belongs to the UPF0103 family. MEMO1 control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. It is required for breast carcinoma cell migration, suggesting an important role in tumorigenesis. Also, it controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02946
Size 100 µg
Host E.coli
Accession
Molecular Weight 36.4kDa (322aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMMSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH
Purity > 95% by HPLC
Concentration 0.5mg/ml
Formulation Liquid. In 20 mM Tris-HCl buffer, pH8.0, 50% glycerol, 5mM DTT, 300mM NaCl, 2mM EDTA
Other Names Protein MEMO1, C2orf4, CGI-27, MEMO, NS5ATP7.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap