Home / Products / proteins / MECR, 54-373aa, Human, His tag, E.coli

MECR, 54-373aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MECR(Mitochondrial trans-2-enoyl-CoA reductase), also known as NRBF1, catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH dependent manner with preference to medium chain length substrate. This protein has a role in the mitochondrial synthesis of fatty acids. Recombinant human MECR protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02938
Size 50 µg
Host E.coli
Accession
Molecular Weight 36.9 kDa (341aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.2M NaCl,5mM DTT, 20% glycerol
Other Names Trans-2-enoyl-CoA reductase, mitochondrial, NRBF1, CGI-63, FASN2B
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap