Home / Products / proteins / MDP1, 1-176aa, Human, His tag, E.coli

MDP1, 1-176aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MDP1 (Magnesium-dependent phosphatase 1) belongs to the HAD-like hydrolase superfamily. This protein is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase. It is inhibited by vanadate and zinc, and slightly by calcium. Recombinant human MDP1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02936
Size 100 μg
Host E.coli
Accession
Molecular Weight 22.7kDa (200aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol,2mM DTT, 100mM NaCl
Other Names Magnesium-dependent phosphatase 1, MDP-1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap