Home / Products / proteins / MCSF, 33-190 aa, Human, His-tagged, Recombinant, E.coli

MCSF, 33-190 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Macrophage colony stimulating factor (M-CSF), as known as CSF-1, one of the hematopoietic growth factors that regulate the growth and differentiation of blood cells. This protein is produced by monocytes, granulocytes, endothelial cells, and fibroblasts. It stimulates the formation of macrophage colonies, enhances antibody-dependent, cell-mediated cytotoxicity by monocytes and macrophages, and inhibits bone resorption by osteoclasts.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02931
Size 100 µg
Host E.coli
Accession
Molecular Weight 20.7 kDa (179aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0), 2mM DTT, 10% glycerol
Other Names Macrophage colony stimulating factor, CSF1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap