MCFD2, 27-146aa, Human, T7 tag, E.coli

Categories: [Proteins / Peptides]
Multiple coagulation factor deficiency 2 (MCFD2), also known as SDNSF. This is expressed by neural stem/progenitor cells of the hippocampus, and localized to region where neurogenesis persists throughout life. It has been found to prevent NSC cell death and to maintain stem cell characteristics. This protein forms a complex with LAMN1 that facilitates the transport of coagulation factors V and VIII from the endoplasmic reticulum to the Golgi apparatus via an endoplasmic reticulum Golgi intermediate compartment.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02928
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.1 kDa (136aa)
AP_Mol_Weight
Tag
Sequences MASMTGGQQMGRGSHMEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH7.5) containing 100mM NaCl, 10% glycerol
Other Names Multiple coagulation factor deficiency 2, SDNSF, LMAN1IP.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap