Home / Products / proteins / MBL2, 108-248aa, Human, His tag, E.coli

MBL2, 108-248aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Mannose-binding protein C, also known as MBL2, is a member of the collectin family of patternrecognition molecules. MBL2 is a secreted glycoprotein that is synthesized as a 248 amino acid precursor. The Protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02923
Size 100 µg
Host E.coli
Accession
Molecular Weight 18 kDa (164aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2M Urea, 20% glycerol, 0.2M Nacl
Other Names Mannose-binding protein C, COLEC1, HSMBPC, MBL, MBL2D, MBP, MBP-C, MBP1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap