MARCKSL1, 1-195aa , Human, His tag, E.coli

Categories: [Proteins / Peptides]
MARCKS-related protein, also known as MARCKSL1, is a member of MARCKS family of PKC substrate. It is widely used in the signal transduction studies as an indicator of PKC activation. Expressed in a variety of tissues with highest levels found in testis and uterus, MARCKSL1 participates in the coordination of membrane-cytoskeletal signaling events, including secretion, migration, phagocytosis and cell adhesion. Additionally, MARCKSL1 functions as a regulator of Integrin activation and is thought to regulate Integrin-dependent signal transduction pathways, especially those involved in macrophage spreading. Recombinant human MARCKSL1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02913
Size 20 µg
Host E.coli
Accession
Molecular Weight 21.9kDa (218aa) confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by BCA assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 20% glycerol
Other Names MARCKS-related protein, F52, MACMARCKS, MLP, MLP1, MRP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap