Home / Products / proteins / MAPRE3, 1-281aa, Human, His tag, E.coli

MAPRE3, 1-281aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MAPRE1 is a microtubule associated protein that interacts with the colorectal adenomatous polyposis coli tumor suppressor protein and plays important roles in regulating microtubule dynamics, cell polarity, and chromosome stability. This protein is related to MAPRE1 and likewise associates with the microtubule cytoskeleton. MAPRE3 is expressed predominantly in the central nervous system and preferentially associates with APCL, a homolog of the adenomatous polyposis coli tumor suppressor protein.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02912
Size 100 µg
Host E.coli
Accession
Molecular Weight 34.1 kDa (301aa) ) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 2mM DTT, 0.1M NaCl.
Other Names microtubule-associated protein, RP/EB family member 3, EB3, EBF3, EBF3-S, RP3.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap