Home / Products / proteins / MAPK13, 1-365aa , Human, His tag E.coli

MAPK13, 1-365aa , Human, His tag E.coli

Categories: [Proteins / Peptides]
MAPK13, also known as mitogen-activated protein kinase 13, is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. It is a related protein that is phosphorylated by MKK6 in response to cytokines and cellular stresses.
List Price: $397
  • Buy 5 for $377.15 each and save 5%
  • Buy 21 for $357.3 each and save 10%
  • Buy 31 for $337.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02903
Size 100 µg
Host E.coli
Accession
Molecular Weight 44.2 kDa (385aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl,1mM DTT
Other Names Mitogen-activated protein kinase 13, MGC99536, p38delta, PRKM13, SAPK4.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap