Home / Products / proteins / MAPK11, 1-364aa, Human, His tag, E.coli

MAPK11, 1-364aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MAPK11 (Mitogen-activated protein kinase 11) is a member of the MAP kinase family. This kinase is most closely related to p38 MAP kinases(MAPKs). MAPKs are activated primarily in response to inflammatory cytokines and cellular stress, and inhibitors which target the MAPK14 and MAPK11 have shown potential for the treatment of inflammatory disease. MAPK11 has been shown to interact with HDAC3 and Promyelocytic leukemia protein.
List Price: $198
  • Buy 5 for $188.1 each and save 5%
  • Buy 21 for $178.2 each and save 10%
  • Buy 31 for $168.3 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02901
Size 10 µg
Host E.coli
Accession
Molecular Weight 43.8kDa (387aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT, 20% glycerol, 100mM NaCl
Other Names Mitogen-activated protein kinase 11, p38-2, P38B; p38Beta, P38BETA2, PRKM11, SAPK2, SAPK2B.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap