Home / Products / proteins / MAGOH, 1-146 aa, Human, His-tagged, Recombinant, E.coli

MAGOH, 1-146 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
MAGOH, the human homolog of Drosophila mago nashi, is required for embryo development. MAGOH is ubiquitously expressed in adult tissues. In mammals, mRNA expression is not limited to the germ plasm, but is expressed ubiquitously in adult tissues and can be induced by serum stimulation of quiescent fibroblasts. Recombinant human MAGOH protein, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02887
Size 100 µg
Host E.coli
Accession
Molecular Weight 18.2 kDa (154aa)
AP_Mol_Weight
Tag
Sequences MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPILEHHHHHH
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 2mM DTT,0.1M NaCl, 20% glycerol
Other Names Protein mago nashi homolog, MAGOH1, MAGOHA
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap