Home / Products / proteins / MAGEA8, 1-318aa, Human, His tag, E.coli

MAGEA8, 1-318aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MAGEA8 also known as Melanoma-associated antigen 8 is a member of the MAGE gene family, which comprises 12 known genes, of which 6 are expressed in tumors. The MAGE genes were initially isolated from different kinds of tumors, and based on their virtually exclusive tumor-specific expression in adult tissues, they have been used as targets for cancer immunotherapy. Recombinant human MAGEA8, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02884
Size 20 µg
Host E.coli
Accession
Molecular Weight 37.6kDa (341aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate Buffered Saline containing 10% glycerol, 1mM DTT
Other Names Melanoma-associated antigen 8, CT1.8, MAGE8
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap