Home / Products / proteins / Lymphotactin/XCL1, 22-114 aa, Human, His-tagged, Recombinant, E.coli

Lymphotactin/XCL1, 22-114 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Lymphotactin, also known as XCL1, is member of gamma or C subfamily of chemokines. It is found in high levels in spleen, thymus, intestine and peripheral blood leukocytes, and at lower levels in lung, prostate gland and ovary. The expression of lymphotactin is restricted to activated T cells such as activated CD8+ T cells and other calss IMHC restricted T cells. Since lymphotactin is produced by lymphocytes and acts on lymphocytes, it is speculated that it is a messenger in T cell chemoattraction.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02865
Size 50 µg
Host E.coli
Accession
Molecular Weight 12.5 kDa (114aa), confirmed by MALDI-TOF (molecular weight on SDS-PAGE will shift up)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 30% glycerol 2 mM DTT, 0.2 M NaCl.
Other Names Chemokine (C motif) ligand 1, XCL1, ATAC, LPTN, LTN, SCM-1, SCM-1a, SCM1, SCYC1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap