Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP02865 |
Size | 50 µg |
Host | E.coli |
Accession | |
Molecular Weight | 12.5 kDa (114aa), confirmed by MALDI-TOF (molecular weight on SDS-PAGE will shift up) |
AP_Mol_Weight | |
Tag | |
Sequences | MGSSHHHHHHSSGLVPRGSHMVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
Purity | > 95% by HPLC |
Concentration | 0.5 mg/ml (determined by Bradford assay) |
Formulation | Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 30% glycerol 2 mM DTT, 0.2 M NaCl. |
Other Names | Chemokine (C motif) ligand 1, XCL1, ATAC, LPTN, LTN, SCM-1, SCM-1a, SCM1, SCYC1 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap