LY6D, 21-98aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
LY6D contains 1 UPAR/Ly6 domain and is expressed exclusively at the outer cell surface of transitional epithelia and the keratinocyte of stratified squamous epithelia. This protein may act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. It marks the earliest stage of B-cell specification. Recombinant human LY6D protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02860
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.8 kDa (101aa), confirmed by MALDI-TOF(Molecular size on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHN
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 50% glycerol.
Other Names Lymphocyte antigen 6D precursor, E48, Ly-6D
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap