Home / Products / proteins / Lxn, 1-222aa, Mouse, His tag, E.coli

Lxn, 1-222aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
Lxn also known as Latexin. The Protein is belongs to the protease inhibitor I47 (latexin) family. Its function is hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. It may play a role in inflammation. Recombinant mouse Lxn, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02859
Size 100 µg
Host E.coli
Accession
Molecular Weight 27.9kDa (245aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMEIPPTHYAASRAASVAENCINYQQGTPHKLFLVQTVQQASKEDIPGRGHKYHLKFSVEEIIQKQVTVNCTAEVLYPQMGQGSAPEVNFTFEGEIGKNPDEEDNTFYQSLMSLKRPLEAQDIPDNFGNVSPQMKPVQHLAWVACGYVMWQNSTEDTWYKMLKIQTVKQVQRNDDFIELDYTILLHDIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEGQAE
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffer Saline (pH7.4) containing 30% glycerol, 1mM DTT
Other Names Latexin , ECI, Endogenous carboxypeptidase inhibitor
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap