Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP02855 |
Size | 50 µg |
Host | E.coli |
Accession | |
Molecular Weight | 24.6kDa (224aa) confirmed by MALDI-TOF |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | MGSSHHHHHHSSGLVPRGSHMGSMSQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM |
Purity | > 95% by HPLC |
Concentration | 0.5 mg/ml (determined by Bradford assay) |
Formulation | Liquid. In PBS buffer (pH 7.4) containing 10% glycerol, 1mM DTT |
Other Names | Tumor necrosis factor receptor superfamily member 3, CD18, D12S370, LT-BETA-R, TNF-R-III, TNFCR, TNFR-RP, TNFR2-RP, TNFR3, TNFRSF3 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap