LSM4, 1-139aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
LSM4, also called U6 snRNA-associated Sm-like protein or glycine-rich protein (GRP), forms donutshaped heptameric complexes that are involved in various steps of RNA metabolism. It facilitates RNA protein interactions and structural changes that are required during ribosomal subunit assembly. It binds specifically to the 3'-terminal U-tract of U6 snRNA. Recombinant human LSM4 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02851
Size 100 μg
Host E.coli
Accession
Molecular Weight 17.5 kDa (159aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl, 1mM DTT
Other Names U6 snRNA-associated Sm-like protein LSm4, YER112W
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap