Home / Products / proteins / LSM1, 1-133aa, Human, His tag, E.coli

LSM1, 1-133aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
U6 snRNA-associated Sm-like protein LSm1, also known as LSM1 plays a role in replicationdependent histone mRNA degradation and binds specifically to the 3'-terminal U-tract of U6 snRNA. LSM1 protein facilitates RNA protein interactions and structural changes that are required during ribosomal subunit assembly. LSM1 is naturally overexpressed in pancreatic cancer as well as in certain breast cancer cell lines.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02848
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.3kDa (153aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 7.5) containing 1mM DTT,10% glycerol, 0.1M NaCl
Other Names U6 snRNA-associated Sm-like protein LSm1, CASM, Small nuclear ribonuclear CaSm
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap