Home / Products / proteins / Livin beta, 1-280aa, Human, His tag, E.coli

Livin beta, 1-280aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Livin isoform beta is a member of the family of inhibitor of apoptosis proteins (IAP) and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING zinc finger (RZF) domain. Livin isoform beta has direct interaction with several caspases including caspase-3, -7, and –9. This protein inhibits the activation of caspase-9 induced by Apaf-1, cytochrome c, and dATP. Recombinant human Livin beta protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02836
Size 50 µg
Host E.coli
Accession
Molecular Weight 33.4kDa (304aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS
Purity > 95% by HPLC
Concentration 0.5 mg/mL (determined by Bradford assay).
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT, 40% glycerol, 300mM NaCl, 1mM EDTA.
Other Names Livin inhibitor of apoptosis isoform beta, BIRC7, KIAP, ML-IAP, MLIAP, RNF50.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap