LIF, 23-202aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
LIF, as known as leukemia inhibitory factor, is a pleiotropic glycoprotein belonging to the LI6 family of cytokines. This protein is involved in growth promotion and cell differentiation of different types of target cells, influence on bone metabolism, embryogenesis and inflammation. It is produced by the adrenal cortex and likely enhances its production of cortisol and aldosterone. Also, it can function as an autocrine growth factor in some pancreatic cancers, but induced differentiation in the leukemic cell line M1. Recombinant human LIF, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02824
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 20.8kDa (189aa)18-40kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAFHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Leukemia inhibitory factor isoform1, LIF, CDF, DIA, HILDA, MLPLI
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap