Home / Products / proteins / LGALS9, 1-322aa, Mouse, His tag, E.coli

LGALS9, 1-322aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
LGALS9 is a member of animal lectins that have an affinity to beta-galactosides and forssman pentasaccharide. It is strongly overexpressed in Hodgkin's disease tissue and it might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its consistently associated immunodeficiency. Recombinant mouse LGALS9 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $198
  • Buy 5 for $188.1 each and save 5%
  • Buy 21 for $178.2 each and save 10%
  • Buy 31 for $168.3 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02819
Size 50 µg
Host E.coli
Accession
Molecular Weight 38kDa (345aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 10% glycerol
Other Names Galectin-9, gal-9, galectin-9, LGALS35, Lgals5, gal9
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap