Home / Products / proteins / LGALS8, 1-317aa, Human, His tag, E.coli

LGALS8, 1-317aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
LGALS8, also known as prostate-specific membrane antigen (PCTA1), is an additional prostatespecific antigen that is overexpressed only in malignant tumors and therefore is a more specific identifier of malignancies. It is a member of the galectin gene family which mediates both cell-cell and cell matrix interactions in a manner similar to the selectin subgroup of C-type lectins.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02818
Size 50 µg
Host E.coli
Accession
Molecular Weight 37.9 kDa (337aa), , confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.1M Nacl,1mM DTT, 10% glycerol
Other Names Galectin-8, Gal-8, PCTA1, Po66-CBP, Prostate carcinoma tumor antigen 1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap