LGALS3, 1-264aa, Mouse, His tag, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
LGALS3, also known as galectin 3, is a member of the family of animal lectins, which selectively binds beta-galactoside residues. This protein is secreted from cells by ectocytosis, which is independent of the classical secretory pathway through the endoplasmic reticulum/Golgi network. LGALS3 has been associated with the inhibition of apoptosis and the progression of cancer. It is normally distributed in epithelia of many organs, in various inflammatory cells, including macrophages, as well as dendritic cells and Kupffer cells. The expression of this lectin is up-regulated during inflammation, cell proliferation, cell differentiation and through trans-activation by viral proteins. Recombinant mouse LGALS3 protein, used to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $122
  • Buy 5 for $115.9 each and save 5%
  • Buy 21 for $109.8 each and save 10%
  • Buy 31 for $103.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02813
Size 10 µg
Host E.coli
Accession
Molecular Weight 29.8 kDa (287aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 50% glycerol,1mM DTT, 2mM EDTA
Other Names Lectin, galactose binding, soluble 3, CBP35, GAL3, GALBP, GALIG, LGALS2, MAC2.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap