Lgals2, 1-130aa, Mouse, His tag, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
Galectin 2, also known as Lgals2, belongs to the galectins family. Galectins are a family of soluble beta-galactoside-binding animal lectins that modulate cell-to-cell adhesion and cell-to-extracellular matrix (ECM) interactions and play a role in tumor progression, pre-mRNA splicing and apoptosis. Lgals2 is a monomeric or homodimeric prototype galectin that is expressed in hepatoma, stomach epithelial cells and in colorectal and neural tumors. It induces apoptosis in activated T cells and binds to the cytokine lymphotoxin-a (LTA) with possible implications in risk of myocardial infarction. Human and mouse Lgals2 share approximately 65% amino acid sequence similarity. Recombinant Mouse Lgals2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $135
  • Buy 5 for $128.25 each and save 5%
  • Buy 21 for $121.5 each and save 10%
  • Buy 31 for $114.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02810
Size 20 µg
Host E.coli
Accession
Molecular Weight 17.3 kDa (153aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMSEKFEVKDLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETLNLHFNPRFDESTIVCNTSEGGRWGQEQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGGLQISSFKLE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol,1mM DTT
Other Names Galectin 2, 2200008F12Rik, AI324147.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap