Home / Products / proteins / LGALS14,1-139aa, Human, His tag, E.coli

LGALS14,1-139aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
LGALS14, also known as Galectin14, belongs to the galectin family of carbohydrate binding proteins. This protein is expressed intracellularly in placenta and eosinophils and is released by eosinophils following allergen stimulation. It may be involved in the development of allergic inflammation. Recombinant human LGALS14 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02808
Size 10 µg
Host E.coli
Accession
Molecular Weight 18.5 kDa (162aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISD
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl, 1mM DTT
Other Names Placental protein 13-like, Galectin-14, Gal-14, CLC2, MGC22235, PPL13
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap