Home / Products / proteins / LDLR chaperone MESD, 30-224aa, Mouse, His tag, E.coli

LDLR chaperone MESD, 30-224aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
MESDC2 also known as LDLR chaperone MESD. This protein is specialized chaperone for low-density lipoprotein receptor-related protein 5 and LRP6. MESDC2 binds to mature LRP6 on the cell surface and blocks the binding of Wnt antagonist Dickkopf-1 to LRP6. Furthermore, MESDC2 plays an essential role in NMJ formation by promoting Lrp4 maturation. Recombinant mouse MESDC2, fused to His-tag at N-terminus was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02797
Size 20 µg
Host E.coli
Accession
Molecular Weight 24.4kDa (218aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSADTPGEATPPPRKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGKGGGSKEKNKTKPEKAKKKEGDPKPRASKEDNRAGSRREDL
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol
Other Names 2210015O11Rik, AW537813, mesd, mKIAA0081, msd.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap