LDHB, 1-334aa, Human, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
LDHB, also known as L-lactate dehydrogenase B chain isoform LDHB, is a member of the lactate dehydrogenase family. It is an oxidoreductase which catalyses the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+. As this protein can also catalyze the oxidation of hydroxybutyrate. The LDH family consists of three members, LDH-A, LDH-B and LDH-C. LDHs function as powerful markers for germ cell tumors. Recombinant human LDHB protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $131
  • Buy 5 for $124.45 each and save 5%
  • Buy 21 for $117.9 each and save 10%
  • Buy 31 for $111.35 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02795
Size 20 µg
Host E.coli
Accession
Molecular Weight 36.6kDa (334aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl (pH 8.0) containing 10% glycerol, 1mM DTT
Other Names Lactate dehydrogenase B, HEL-S-281, LDH-B, LDH-H, LDHBD, TRG-5, Epididymis secretory protein Li 281, HEL S 281, L lactate dehydrogenase B chain.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap