Ldha, 1-332aa, Mouse, His tag, Baculovirus (Bioactivity Validated)

Categories: [Proteins / Peptides]
Ldha, also known as L-lactate dehydrogenase A chain isoform 1, is a member of the LDH/MDH superfamily and LDH family. It catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. This protein is found predominantly in muscle tissue. It has long been known that many human cancers have higher LDHA levels compared to normal tissues. It plays an important role in the development, invasion and metastasis of malignancies. Recombinant mouse Ldha, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $154
  • Buy 5 for $146.3 each and save 5%
  • Buy 21 for $138.6 each and save 10%
  • Buy 31 for $130.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02793
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 37.5kDa (340aa), 28-40KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQFLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names L-lactate dehydrogenase A chain isoform 1, Ldha, 17R2, Ldh1, Ldhm
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap