Home / Products / proteins / LCN2, 21-198aa, Human, His tag, E.coli

LCN2, 21-198aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Neutrophil gelatinase-associated lipocalin (NGAL), also known as LCN2, belongs to the calycin superfamily and Lipocalin family. LCN2 is an iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. The binding of LCN2 to bacterial siderophores is important in the innate immune response to bacterial infection.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02789
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.8kDa (199aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 1mM DTT, 50mM NaCl
Other Names Neutrophil gelatinase-associated lipocalin, Lipocalin-2, MSFI, NGAL, Oncogene 24p3, p25, HNL
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap