Latexin, 1-222aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Latexin, a carboxypeptidase A inhibitor, is highly expressed in heart, prostate, ovary, kidney, pancrease, and colon, moderaqte or low in other tissues including brain. Latexin has no detectable sequence similarity with plant and parasite inhibitors, but it is related to a human putative tumor suppressor protein, TIG1. It is down-regulated in the presenilin-1-deficient mouse brain, thus putatively playing a role in Alzheimer's disease
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02783
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.7 kDa (222aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 50 mM NaCl,10% glycerol
Other Names LXN, ECI, TCI, MUM
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap