Home / Products / proteins / LAT, 28-233 aa, Human,His tag, E.coli

LAT, 28-233 aa, Human,His tag, E.coli

Categories: [Proteins / Peptides]
LAT is an integral membrane protein which is phosphorylated by ZAP-70/Syk protein tyrosine kinases following activation of the T-cell antigen receptor (TCR) signal transduction pathway. LAT is expressed in T lymphocytes in interstitial spaces, platelets and megakaryocytes. LAT is not expressed in B cells, macrophages, plasma cells, monocytes, epithelial histiocytes and dendritic cells.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02782
Size 50 µg
Host E.coli
Accession
Molecular Weight 24.4 kDa (227aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 1mM DTT
Other Names Linker for activation of T-cells family member 1 isoform b, LAT1, pp36.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap