Lair1, 22-144aa, Mouse, His-tag, Baculovirus

Categories: [Proteins / Peptides]
Lair1, as known as leukocyte-associated immunoglobulin-like receptor 1 isoform a, is an inhibitory receptor of the lg superfamily that is related to inhibitory members of KIR and ILT/CD85 families. This protein is well expressed NK cells, T cells, B cells, monocytes, macrophages, immature neutrophils, dendritic cells and most thymocytes. Also, it functions as an inhibitory receptor not only on NK cells, but on human T cells. Recombinant mouse Lair1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02774
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 15.0kDa (132aa), 18-28kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPQEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTYSIYHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Leukocyte-associated immunoglobulin-like receptor 1 isoform a, Lair1, 5133400O11Rik, BB115266, D7Bwg0421e, Lair-1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap