LAGE3, 1-143aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
L antigen family member 3, also known as LAGE3, belongs to the CTAG family. Members of the LAGE/ESO gene family are clustered together on human chromosome Xq28 and have similar exon-intron structures. Unlike the other family members, which are normally expressed only in testis and activated in a wide range of human tumors, LAGE3 is ubiquitously expressed in somatic tissues. This protein is also highly conserved in mouse and rat, suggesting that the encoded protein is functionally important. Recombinant human LAGE3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02772
Size 20 µg
Host E.coli
Accession
Molecular Weight 17.2kDa (166aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPPVSR
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl,50% glycerol, 2mM DTT
Other Names L antigen family member 3, CVG5, DXS9879E, DXS9951E, ESO3, ITBA2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap