Home / Products / proteins / KLRK1, 73-216 aa, Human, His tag, E.coli

KLRK1, 73-216 aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
KLRK1 is an activating receptor that has recently generated considerable interest. The most intriguing of these are a pair of closely related proteins called MICA and MICB. These are cell-surface molecules distantly related to MHC class I proteins, and the genes possess elements of heat shock promoters. MICA and MICB, therefore, are expressed during cell stress and are up-regulated in tumor cells and during viral infections.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02758
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.2 kDa(168aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.4M Urea
Other Names NKG2-D type II integral membrane protein, CD314, D12S2489E, KLR, NKG2-D, NKG2D
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap