Klk8, 29-260aa, Mouse, His-tag, Baculovirus

Categories: [Proteins / Peptides]
Klk8, as known as kallikrein-8, is a member of the tissue kallikrein family. This protein is capable of degrading a number of proteins such as casein, fibrinogen, fibronectin and collagen type IV. Also, it cleaves L1CAM in response to increased neural activity and induces neurite outgrowth and fasciculation of cultured hippocampal neurons. It plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Recombinant mouse Klk8, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02753
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 26.5kDa (240aa) 28-40kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences QGSKILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRDLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Kallikrein-8, Klk8, BSP1, NP, Nrpn, Prss19, Neuropsin
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap