KLK7, 1-181aa, Human, His tag, Baculovirus

Categories: [Proteins / Peptides]
KLK7, as known as kallikrein-7 isoform 2, is a secreted protein which belongs to the peptidase S1 family and kallikrein subfamily. Members of the kallikrein family are involved in various malignancies such as prostate (PSA, KLK2, KLK15), ovarian (KLK4, KLK5, KLK6, KLK8, KLK10), and breast cancer (KLK10, KLK13, LKL14). This protein is expressed in the skin, a major physiological function of KLK7 is to regulate the desquamation process through proteolysis of the intercellular adhesive structure between corneocytes. Recombinant human KLK7, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02751
Size 20 µg
Host Baculovirus
Accession
Molecular Weight 20.9kDa (190aa); 28-40kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences ADPMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHRHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Kallikrein-7 isoform 2, KLK7, hK7, PRSS6, SCCE
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap