Home / Products / proteins / KLK2, 25-261aa, Human, His-tag, Baculovirus

KLK2, 25-261aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
KLK2, also known as kallikerin-2 isoform1, is a secreted serine protease that is highly expressed in the human prostate gland. The enzyme is highly specific for cleavage after arginine residues. This protein is able to activate the urokinase-type plasminogen activator. It is inhibited by serpins such as protein C inhibitor, antichymotrypsin and plasminogen activator inhibitor. Recombinant human KLK2, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02747
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 27.2kDa (246aa), 28-40KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANPHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Kallikerin-2 isoform1 , KLK2, hGK-1, hK2, KLK2A2, Glandular kallikrein 2Glandular kallikrein-1, hGK 1, hGK-1, hK2, Kallikrein 2 prostatic, Kallikrein related peptidase 2, kallikrein.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap