KIR3DL1(Cytoplasmic tail, 361-444aa, His-tag, Human), Recombinant, E.coli

Categories: [Proteins / Peptides]
The three Ig-domain from of inhibitory killer cell Ig-like receptor 1(KIR3DL1,NKB1, nkat3, p70KIR) is a NK cell receptor for polymorphic HLA-B determinant. KIR3DLl recognizes the Bw4 determinant defined by sequence motifs at positins 77-83 of the HLA-B heavy chain. The cytoplasmic tail of KIR, which contains two immunoreceptor tyrosine-based inhibition motifs(ITIMs), mediates inhibitory signal transduction that prevents killer cell-mediated cytotoxicity. A His-tag fusion protein of KIR3DL1 cytoplasmic tail(361-444aa) was overexpressed as insoluble protein aggregates(inclusion bodies). This protein was purified by FPLC gel-filtration chromatography, after refolding of the isolated inclusion bodies in a redox buffer.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02731
Size 100 µg
Host E.coli
Accession
Molecular Weight 15 kDa (132 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSTSGTIDKLDIEFHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 25 mM Tris-HCl buffer (pH 7.5) containing 100 mM NaCl
Other Names Killer cell immunoglobulin-like receptor 3DL1, CD158E1, KIR, NKAT3, NKB1, NKB1B
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap