Home / Products / proteins / KIR2DL3(p58 KIR, CD158), Human, Recombinant, Recombinant, E.coli

KIR2DL3(p58 KIR, CD158), Human, Recombinant, Recombinant, E.coli

Categories: [Proteins / Peptides]
An inhibitory Killer Cell Ig-like Receptor(KIR, previously called p58 KIR, cl-6, NKAT2 or KIR-K7), which recognizes class I MHC molecules(HLA-Cw1, -Cw3, -Cw7, and Cw8). The protein coding region of the extracellular domain of KIR2DL3(amino acid 1-202) was cloned into an E. coli expression vector. The extracellular domain of KIR2DL3 protein was purified by FPLC gel-filtration chromatography, after refolding of the isolated inclusion bodies in a redox buffer.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02729
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.2kDa (202aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGISKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5)
Other Names Killer cell immunoglobulin-like receptor 2DL3, NKAT-2, p58 NK receptor, CD158b2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap