KIR2DL1(p58 KIR, CD158), Human, Recombinant, Recombinant, E.coli

Categories: [Proteins / Peptides]
An inhibitory Keller Cell Ig-like Receptor(KIR, previously called p58 KIR, p58.1, cl-42, NKAT1, or KIRK6), which recognizes class I MHC molecules(HLA-Cw2, -Cw4, -Cw5, and Cw6). The protein coding region of the extracellular domain of KIR2DL1(amino acids 1-202) was cloned into an E. coli expression vector. The extracellular domain of KIR2DL1 was overexpressed as insoluble protein aggregates(inclusion bodies). The recombinant KIR2DL1 protein was purified by FPLC gel-filtration chromatography, after refolding of the isolated inclusion bodies in a redox buffer.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02728
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.2kDa (202aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5)
Other Names Killer cell immunoglobulin-like receptor 2DL1, NKAT-1, p58 NK receptor, CD158a
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap