Home / Products / proteins / KDSR, 26-270aa, Human, His tag, E.coli

KDSR, 26-270aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
KDSR, also known as 3-ketodihydrosphingosine reductase, is a 332 amino acid multi-pass membrane protein that localizes to the endoplasmic reticulum (ER) and belongs to the short-chain dehydrogenases/reductases (SDR) family. KDSR is a secreted protein which is weakly expressed in hematopoietic tissue. Also this protein catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02722
Size 100 µg
Host E.coli
Accession
Molecular Weight 29.0 kDa (266aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSD
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT,10% glycerol, 0.1M NaCl, 0.1mM PMSF
Other Names 3-ketodihydrosphingosine reductase, DHSR, FVT1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap