Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP02717 |
Size | 50 µg |
Host | E.coli |
Accession | |
Molecular Weight | 28 kDa (252aa) |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | MGSSHHHHHHSSGLVPRGSHMLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLWTGGPGERREVVGTPSFLEEVLRVALEHGFRLDSVFPDPEDLLNSRSLRFVRH |
Purity | > 95% by HPLC |
Concentration | 0.5 mg/ml (determined by Bradford assay) |
Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 10% glycerol |
Other Names | BTB/POZ domain-containing protein KCTD11, C17orf36, KCASH1, MGC129844, REN, REN/KCTD11 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap