Home / Products / proteins / KCTD11, 1-232aa, Human, His tag, E.coli

KCTD11, 1-232aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
BTB/POZ domain-containing protein KCTD11, is a 232 amino acid regulator of neuronal differentiation that induces growth arrest, apoptosis and the expression of p27, a cyclin-dependent kinase inhibitor. Expressed at highest levels in cerebellum, KCTD11 functions as an antagonist of the Hedgehog pathway and activator of the caspase cascade. Recombinant human KCTD11 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02717
Size 50 µg
Host E.coli
Accession
Molecular Weight 28 kDa (252aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLWTGGPGERREVVGTPSFLEEVLRVALEHGFRLDSVFPDPEDLLNSRSLRFVRH
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 10% glycerol
Other Names BTB/POZ domain-containing protein KCTD11, C17orf36, KCASH1, MGC129844, REN, REN/KCTD11
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap