KAAG1, 1-84aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Kidney associated antigen 1, also known as KAAG1, is expressed in testis and kidney, and, at lower levels, in urinary bladder and liver. And it is expressed by a high proportion of tumors of various histologic origin, including melanomas, sarcomas and colorectal carcinomas. Recombinant human KAAG1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02713
Size 10 µg
Host E.coli
Accession
Molecular Weight 11.1kDa (104aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by BCA)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT,10% glycerol, 100mM NaCl
Other Names Kidney associated antigen 1, RU2AS
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap