JAK2, 1014-1132aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
JAK2 is a protein tyrosine kinase involved in a specific subset of cytokine receptor signaling pathways. It has been found to be constituitively associated with the prolactin receptor and is required for responses to gamma interferon. Mice that do not express an active protein for this gene exhibit embryonic lethality associated with the absence of definitive erythropoiesis. Recombinant human Jak2 protein, fused to His-tag at N-terminus, was expressed in E.coli
List Price: $198
  • Buy 5 for $188.1 each and save 5%
  • Buy 21 for $178.2 each and save 10%
  • Buy 31 for $168.3 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02703
Size 100 µg
Host E.coli
Accession
Molecular Weight 18.1kDa (157aa)
AP_Mol_Weight
Tag N-6His
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing , 10% glycerol, 0.4M Urea
Other Names Janus kinase 2, Janus kinase 2 (a protein tyrosine kinase), JTK10
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap