ITGB3BP, 1-216aa, Human His tag, E.coli

Categories: [Proteins / Peptides]
Cntromere protein R isoform 1, also known as ITGB3BP1, is a widely expressed protein that contains a DD1 or RepD1 domain and an LXXLL motif. Induced by estrogen, ITGB3BP1 is believed to function as a nuclear receptor coactivator. It also associates with the CENP-A-CAD complex which is involved in mitotic progression, the assembly of kinetochore proteins and chromosome segregation. It acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. Recombinant human ITGB3BP1 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02697
Size 20 µg
Host E.coli
Accession
Molecular Weight 27.1 kDa (239aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMPFAPVAQARVQWHDFRSLQHLLPAFKRFSCLSLGSSWDYSVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 10% glycerol
Other Names Cntromere protein R isoform 1, CENP-R, CENPR, HSU37139, NRIF3, TAP20
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap