ISCU, 35-167aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Iron-sulfur cluster assembly enzyme, also known as ISCU, is a member of the nifU family. Iron-sulfur (Fe-S) clusters are necessary for several mitochondrial enzymes and other subcellular compartment proteins. It is interact with ISCS, a cysteine desulfurase, to sequester inorganic sulfur for Fe-S cluster assembly. ISCU-ISCS protein complex localizes in both mitochondria and cytosol, implying that Fe-S cluster assembly takes place in multiple subcellular compartments in mammalian cells
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02690
Size 10 μg
Host E.coli
Accession
Molecular Weight 16.7kDa (154aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol2mM DTT, 100mM NaCl
Other Names Iron-sulfur cluster assembly enzyme ISCU, HML, hnifU, ISU2, NIFU, NIFUN
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap