Home / Products / proteins / IRGM, 23-181aa, Human, His tag, E.coli

IRGM, 23-181aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Immunity-related GTPase family M protein, also known as IRGM, is required for clearance of acute protozoan and bacterial infections. This protein functions in innate immune response probably through regulation of autophagy. It may regulate proinflammatory cytokine production and prevent endotoxemia upon infection and may also play a role in macrophages adhesion and motility. Recombinant human IRGM protein, fused to His-tag at Nterminus, was expressed in E.coli.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02689
Size 100 µg
Host E.coli
Accession
Molecular Weight 20.1 kDa (180aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2M urea, 10% glycerol
Other Names Immunity-related GTPase family M protein, IFI1, IRGM1, LRG-47, LRG47, MGC149263, MGC149264
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap