Interleukin 6, 30-212aa, Human, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
IL6, also known as interleukin 6. It is a cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. This protein plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation. Recombinant human IL6 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $122
  • Buy 5 for $115.9 each and save 5%
  • Buy 21 for $109.8 each and save 10%
  • Buy 31 for $103.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02674
Size 5 µg
Host E.coli
Accession
Molecular Weight 20.9kDa (184aa)
AP_Mol_Weight
Tag
Sequences MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by BCA)
Formulation Liquid. In phosphate buffered saline (pH 7.4)
Other Names BSF2, HGF, HSF, IFNB2, IL-6.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap