Interleukin-17A, 26-158aa, Mouse, His tag, Insect cell

Categories: [Proteins / Peptides]
IL17A, also known as Interleukin-17A, plays an important role in anti-microbial and chronic inflammation. Mature human IL17A shares 60% amino acid sequence identity with mouse and rat IL17A. It promotes protective mucosal and epidermal inflammation in response to microbial infection and induces chemokine production, neutrophil influx, and the production of antibacterial peptides. Recombinant mouse IL17A, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02678
Size 50 µg
Host Insect cell
Accession
Molecular Weight 16.0kDa (141aa), 13.5-18KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAALEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names IL17A, Ctla-8, Ctla8, IL-17, IL-17A, Il17
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap